The domain within your query sequence starts at position 3 and ends at position 84; the E-value for the MCLC domain shown below is 4.2e-37.
CRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQVRSGTSEKKEVSPDSSEAE ELSDCLHRLDSLTHKVDSCEKK
MCLC |
 |
|---|
| PFAM accession number: | PF05934 |
|---|---|
| Interpro abstract (IPR009231): | This entry consists of several Chloride channel CLIC-like proteins, which function as a chloride channel when incorporated in the planar lipid bilayer [ (PUBMED:11279057) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCLC