SMART: Pfam domain MCRS

The domain within your query sequence starts at position 121 and ends at position 318; the E-value for the MCRS_N domain shown below is 2.4e-97.

RWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFTLREVQERWYALLYDPVISKLACQAMR
QLHPEAIAAIQSKALFSKAEEQLLSKVGSSSQPTLETFQDLLHTHPDAFYLARTAKALQA
HWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEVLEHELTVADRRQK
REIRQLEQELHKWQVLVD

MCRS_N

PFAM accession number:	PF13325
Interpro abstract (IPR025999):	This domain is found in plants and higher eukaryotes, and is the N-terminal region of micro-spherule proteins which repress the transactivation activities of Nrf1 (p45 nuclear factor-erythroid 2 (p45 NF-E2)-related factor 1) [ (PUBMED:17014843) ]. In conjunction with DIPA the full-length protein acts as a transcription repressor [ (PUBMED:19187526) ]. The exact function of this domain is not known.

PFAM accession number:

PF13325

Interpro abstract (IPR025999):

This domain is found in plants and higher eukaryotes, and is the N-terminal region of micro-spherule proteins which repress the transactivation activities of Nrf1 (p45 nuclear factor-erythroid 2 (p45 NF-E2)-related factor 1) [ (PUBMED:17014843) ]. In conjunction with DIPA the full-length protein acts as a transcription repressor [ (PUBMED:19187526) ]. The exact function of this domain is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MCRS_N