The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the MIOX domain shown below is 7.2e-20.

XPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNLISTRSALTYR

MIOX

MIOX
PFAM accession number:PF05153
Interpro abstract (IPR007828):

Inositol oxygenase ( EC 1.13.99.1 ) is involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers. It may be also involved in plant ascorbate biosynthesis [ (PUBMED:15660207) (PUBMED:14976233) ].

GO process:inositol catabolic process (GO:0019310), oxidation-reduction process (GO:0055114)
GO component:cytoplasm (GO:0005737)
GO function:inositol oxygenase activity (GO:0050113), iron ion binding (GO:0005506)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MIOX