The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the MIOX domain shown below is 7.2e-20.
XPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNLISTRSALTYR
MIOX |
![]() |
---|
PFAM accession number: | PF05153 |
---|---|
Interpro abstract (IPR007828): | Inositol oxygenase ( EC 1.13.99.1 ) is involved in the biosynthesis of UDP-glucuronic acid (UDP-GlcA), providing nucleotide sugars for cell-wall polymers. It may be also involved in plant ascorbate biosynthesis [ (PUBMED:15660207) (PUBMED:14976233) ]. |
GO process: | inositol catabolic process (GO:0019310), oxidation-reduction process (GO:0055114) |
GO component: | cytoplasm (GO:0005737) |
GO function: | iron ion binding (GO:0005506), inositol oxygenase activity (GO:0050113) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MIOX