The domain within your query sequence starts at position 72 and ends at position 124; the E-value for the MIS13 domain shown below is 2.7e-10.
QLRSFHLSPQEQSIRPQDRRQSWRRASMKEVNRRKSLAPFHPGITELCRSISV
MIS13 |
---|
PFAM accession number: | PF08202 |
---|---|
Interpro abstract (IPR013218): | This entry represents the kinetochore-associated protein Dsn1/Mis13. In Saccharomyces cerevisiae, Dsn1 acts as essential component of the kinetochore MIND complex, which is required for the spindle checkpoint and kinetochore integrity. MIND plays a role in establishing a bipolar spindle-kinetochore interaction by joining kinetochore subunits contacting DNA to those contacting microtubules [ (PUBMED:12455957) (PUBMED:14633972) ]. In Schizosaccharomyces pombe, Mis13 acts as a component of the NMS (Ndc80-MIND-Spc7) super complex which has a role in kinetochore function during late meiotic prophase and throughout the mitotic cell cycle. It is required for correct segregation of chromosomes and for maintaining the inner centromere structure [ (PUBMED:16079914) (PUBMED:17035632) ]. |
GO process: | cell division (GO:0051301), chromosome segregation (GO:0007059) |
GO component: | MIS12/MIND type complex (GO:0000444) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MIS13