The domain within your query sequence starts at position 238 and ends at position 299; the E-value for the MIT domain shown below is 6.9e-13.
YLEKAGELIKLALKKEEEDDYEAASDFYRKGVDLLLEGVQGKVRQCHHWLESLGSLQKSE RN
MIT |
![]() |
---|
PFAM accession number: | PF04212 |
---|---|
Interpro abstract (IPR007330): | The MIT domain forms an asymmetric three-helix bundle. It is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking. A 'variant' MIT domain has been described at the N-terminal region of a related AAA-ATPase, mammalian katanin p60 [ (PUBMED:20339000) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MIT