The domain within your query sequence starts at position 182 and ends at position 289; the E-value for the MMR_HSR1 domain shown below is 1.1e-8.

VVTVMGHVDHGKTTLLDKLRETQVAAMEVGGITQHIGAFLVSLPSGEKITFLDTPGHAAF
SAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAEVPIILAINK

MMR_HSR1

MMR_HSR1
PFAM accession number:PF01926
Interpro abstract (IPR006073):

Several proteins have recently been shown to contain the 5 structural motifs characteristic of GTP-binding proteins [ (PUBMED:1449490) ]. These include murine DRG protein; GTP1 protein from Schizosaccharomyces pombe; OBG protein from Bacillus subtilis [ (PUBMED:12429099) ]; ferrous iron transport protein B [ (PUBMED:20123128) ] and several others.

GO function:GTP binding (GO:0005525)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMR_HSR1