The domain within your query sequence starts at position 8 and ends at position 83; the E-value for the MMtag domain shown below is 5.7e-34.
GVRGGQDQFNWEDVKTDKQRENYLGNSLMAPVGRWQKGRDLTWYAKDRAPCTGPSREEEL AAVREAEREALLAALG
MMtag |
 |
|---|
| PFAM accession number: | PF10159 |
|---|---|
| Interpro abstract (IPR019315): | This entry represents a glycine-rich domain found in MMTA2 (multiple myeloma tumor-associated protein 2). The region may contain nuclear localisation signals, so it might act as a signal molecule in the nucleus [ (PUBMED:12545221) (PUBMED:20663773) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MMtag