The domain within your query sequence starts at position 26 and ends at position 105; the E-value for the MNNL domain shown below is 4.2e-31.
PMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTPT GPCSYGYGATPVLGGNSFYL
MNNL |
![]() |
---|
PFAM accession number: | PF07657 |
---|---|
Interpro abstract (IPR011651): | This entry represents a region of conserved sequence at the N terminus of several Notch ligand proteins, including Delta-like protein 1 (DLL1) and 4 (DLL4) [ (PUBMED:25715738) (PUBMED:25700513) ]. |
GO process: | Notch signaling pathway (GO:0007219), multicellular organism development (GO:0007275) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MNNL