The domain within your query sequence starts at position 1 and ends at position 117; the E-value for the MOR2-PAG1_N domain shown below is 5.3e-40.
YPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFV EMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKVRHCY
MOR2-PAG1_N |
![]() |
---|
PFAM accession number: | PF14222 |
---|---|
Interpro abstract (IPR025614): | This entry represents the conserved N-terminal domain of proteins that are involved in cell morphogenesis. Among these are furry proteins and homologues [ (PUBMED:11526084) (PUBMED:16061630) ], and proteins PAG1 [ (PUBMED:11854408) ] and Mor2 [ (PUBMED:12234926) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOR2-PAG1_N