The domain within your query sequence starts at position 1590 and ends at position 1660; the E-value for the MOR2-PAG1_mid domain shown below is 1.1e-5.
PGLPLHRCNIAVILLTDLIIDHSVKVEWGSYLHLLLHAIFIGFDHCHPEVYEHCKRLLLH LLIVMGPNSDI
MOR2-PAG1_mid |
![]() |
---|
PFAM accession number: | PF14228 |
---|---|
Interpro abstract (IPR029473): | This entry represents the central region of proteins that are involved in cell morphogenesis. Among these are furry proteins from flies [ (PUBMED:11526084) (PUBMED:16061630) ], proteins PAG1 from budding yeasts [ (PUBMED:11854408) ] and Mor2 from fission yeasts [ (PUBMED:12234926) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOR2-PAG1_mid