The domain within your query sequence starts at position 58 and ends at position 179; the E-value for the MOSC_N domain shown below is 1e-39.
VGTVAQLWIYPIKSCKGLSVSEAECTAMGLRYGHLRDRFWLVINEEGNMVTARQEPRLVL ISLTCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCGEDAAQWVSSFLK MQ
MOSC_N |
![]() |
---|
PFAM accession number: | PF03476 |
---|---|
Interpro abstract (IPR005303): | This domain is found to the N terminus of MOSC domain ( IPR005302 ). The function of this domain is unknown, however it is predicted to adopt a beta barrel fold. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOSC_N