The domain within your query sequence starts at position 561 and ends at position 748; the E-value for the MOZ_SAS domain shown below is 5.9e-92.
WFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQN DVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEK PLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGVCPQDITSTLHHLRMLDFRS DQFVIIRR
MOZ_SAS |
![]() |
---|
PFAM accession number: | PF01853 |
---|---|
Interpro abstract (IPR002717): | Histone acetyltransferases (HATs) fall into at least four different families based on sequence conservation within the HAT domain [ (PUBMED:18722564) ]. The MYST family is the largest family of HATs and is named after the founding members: MOZ, Ybf2/ Sas3, Sas2 and Tip60. MYST proteins mediate many biological functions including gene regulation, DNA repair, cell-cycle regulation and development [ (PUBMED:21132344) ] and have been shown to acetylate several non-histone substrates [ (PUBMED:19303850) ]. MYST proteins are autoregulated by posttranslational modifications [ (PUBMED:22020126) ]. The MYST-type HAT domain contains three regions: a central region associated with acetyl-CoA cofactor binding and catalysis in addition to flanking N- and C-terminal regions harboring respectively a C2HC-type zinc finger and a helix- turn-helix DNA-binding motif. The N- and C-terminal segments directly flanking the catalytic core are likely to play an important role in histone substrate binding [ (PUBMED:11106757) (PUBMED:17925393) ]. The catalytic mechanism for the MYST-type HAT domain is still unresolved but seems to involve a conserved glutamate that functions to abstract a proton from lysine to promote the nucleophilic attack on the acetyl carbonyl carbon of acetyl-CoA [ (PUBMED:11106757) (PUBMED:22918831) (PUBMED:22020126) (PUBMED:18245364) ]. |
GO process: | histone acetylation (GO:0016573), regulation of transcription, DNA-templated (GO:0006355) |
GO function: | histone acetyltransferase activity (GO:0004402) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MOZ_SAS