The domain within your query sequence starts at position 1 and ends at position 125; the E-value for the MRFAP1 domain shown below is 9.8e-50.
MRPLDAVELAEPEEVEVLEPEEDFEQFLLPVIHEMREDIASLTRERGRAPARNRGKLWEM DNMLIQIKTQVEASEESALNHLQGAGGAEPRGPRAEKADEKAQEMAKMAEMLVQLVRRIE KSESS
MRFAP1 |
---|
PFAM accession number: | PF15155 |
---|---|
Interpro abstract (IPR029254): | MRFAP1 (MORF4 family-associated protein 1) and its interaction partner MORF4L1 (or MRG15) are target proteins of the NEDD8-cullin pathway, which plays an important role in the degradation of cell cycle regulators and transcriptional control networks. It has been suggest that MRFAP1 competes with MRGBP for binding to MORF4L1, thereby regulating MORF4L1 function in chromatin modification [ (PUBMED:22038470) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRFAP1