The domain within your query sequence starts at position 667 and ends at position 702; the E-value for the MRF_C1 domain shown below is 1.1e-26.
LVVNKERIFMENVGAVKELCKLTDNLETRIDELERW
MRF_C1 |
![]() |
---|
PFAM accession number: | PF13887 |
---|---|
Interpro abstract (IPR026932): | Myelin gene regulatory factor is a transcription regulator required in vertebrates for expression of central nervous system (CNS) myelin genes such as Mbp and Mog, thereby playing a central role in oligodendrocyte maturation and CNS myelination [ (PUBMED:19596243) ]. It is also required for the maintenance of expression of myelin genes and the mature oligodendrocytes identity in the adult CNS [ (PUBMED:22956843) ]. A Caenorhabditis elegans orthologue, pqn-47, may function as a regulator of molting [ (PUBMED:21989027) ], while a Dictyostelium orthologue has been described to regulate prestalk differentiation [ (PUBMED:22811266) ]. This domain is found towards the C terminus of myelin gene regulatory factor. The function of this domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRF_C1