The domain within your query sequence starts at position 801 and ends at position 936; the E-value for the MRF_C2 domain shown below is 7e-52.

SLTSIQLLENSMPITSQYCVPEGACRLGNFTYHIPVSSSTPLHLSLTLQMNSSTPVSVVL
CSLTSEEEPCEEGGFLQRFHPHQDTQGTSHQWPVTILSFREFTYHFRVTLLGQANCSSEA
IVQPATDYYFHFYRLC

MRF_C2

MRF_C2
PFAM accession number:PF13888
Interpro abstract (IPR025719):

This domain is found at the C terminus of myelin gene regulatory factor. The function of the domain is not known.

Myelin gene regulatory factor is a transcription regulator required in vertebrates for expression of central nervous system (CNS) myelin genes such as Mbp and Mog, thereby playing a central role in oligodendrocyte maturation and CNS myelination [ (PUBMED:19596243) ]. It is also required for the maintenance of expression of myelin genes and the mature oligodendrocytes identity in the adult CNS [ (PUBMED:22956843) ]. A Caenorhabditis elegans orthologue, pqn-47, may function as a regulator of molting [ (PUBMED:21989027) ], while a Dictyostelium orthologue has been described to regulate prestalk differentiation [ (PUBMED:22811266) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRF_C2