The domain within your query sequence starts at position 45 and ends at position 142; the E-value for the MRP-S32 domain shown below is 6.8e-46.
QVDLALTADGRTIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILKAKLEVRKSKQLE QGPMIEQLSKVFYTTKHRWYPHGQYHNRRKKLNPPRDR
MRP-S32 |
 |
|---|
| PFAM accession number: | PF10210 |
|---|---|
| Interpro abstract (IPR019346): | This entry represents a family of short proteins; each approximately 100 amino acid residues in length. They are identified as the mitochondrial 39S ribosomal protein L42. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MRP-S32