SMART: Pfam domain MTBP

The domain within your query sequence starts at position 1 and ends at position 270; the E-value for the MTBP_N domain shown below is 1.2e-116.

MDRYLLLVTWREGKFRSVAGGEIEPGTEATSLESTDKQPDLTATNIYHLLKRSISDSIHP
DDSTFPACSVGGTPHSRKWFFAVQAICGFYQFCSSDWQEIHFDAEKDKIEDVLQANIEEC
QSAVECFEEDDSNSRESLPLADLYEESAENLHQLSDKLPAPGRAMIDIILLPSDKDPPKL
KECLPIVGALKHLKEWHSAKVIIAGSYCEINCQKIAEYLSASVVPLEEFRNAIDPRELWR
GEIQMRERKFGFEISFPEFCLKGVTPTNVS

MTBP_N

PFAM accession number:	PF14918
Interpro abstract (IPR029421):	This entry represents the N-terminal domain of the MDM2-binding protein (MTBP). MDM2 is an E3 ubiquitin-protein ligase that mediates ubiquitination of p53, leading to its degradation by the proteasome [ (PUBMED:14707283) ]. MTBP inhibits autoubiquitination of MDM2, thereby enhancing MDM2 stability, and this promotes MDM2-mediated ubiquitination of p53 and its subsequent degradation [ (PUBMED:15632057) ]. Mouse MTBP also inhibits cancer cell migration by interacting with alpha-actinin-4 (ACTN4) [ (PUBMED:22370640) ].

PFAM accession number:

PF14918

Interpro abstract (IPR029421):

This entry represents the N-terminal domain of the MDM2-binding protein (MTBP). MDM2 is an E3 ubiquitin-protein ligase that mediates ubiquitination of p53, leading to its degradation by the proteasome [ (PUBMED:14707283) ]. MTBP inhibits autoubiquitination of MDM2, thereby enhancing MDM2 stability, and this promotes MDM2-mediated ubiquitination of p53 and its subsequent degradation [ (PUBMED:15632057) ]. Mouse MTBP also inhibits cancer cell migration by interacting with alpha-actinin-4 (ACTN4) [ (PUBMED:22370640) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MTBP_N