The domain within your query sequence starts at position 1 and ends at position 253; the E-value for the MTBP_mid domain shown below is 2.3e-119.
MAKKPKTISVPDVAVKGEFSGYHLLLQGMGKRKCRATLLHSASQINGSFALSVIHGKMKT KAGEARPSFPFDFSSLPRFSEEQVLQREKQLASFQVLALKECLKRRKAANQPEAFSADEL KSLLALTRERFLGHFDVLPTEAALAQTDTVKAAGVVNDDGTVEPYSSSLMETNPLEWPER HVLQNLETSEKAKQKMRTGSLPRSSEQLLGHKEGPRDSLTLLDAKELLKYFTSDGLPVGD LQPLHIQRGEKPF
MTBP_mid |
---|
PFAM accession number: | PF14919 |
---|---|
Interpro abstract (IPR029420): | This entry represents the central domain of the MDM2-binding protein (MTBP). MDM2 is an E3 ubiquitin-protein ligase that mediates ubiquitination of p53, leading to its degradation by the proteasome [ (PUBMED:14707283) ]. MTBP inhibits autoubiquitination of MDM2, thereby enhancing MDM2 stability, and this promotes MDM2-mediated ubiquitination of p53 and its subsequent degradation [ (PUBMED:15632057) ]. Mouse MTBP also inhibits cancer cell migration by interacting with alpha-actinin-4 (ACTN4) [ (PUBMED:22370640) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MTBP_mid