The domain within your query sequence starts at position 528 and ends at position 656; the E-value for the MVP_shoulder domain shown below is 5.9e-55.
GPDFFTDVITIETADHARLQLQLAYNWHFELKNRNDPEETAKLFSVPDFVGDACKAIASR VRGAVASVTFDDFHKNSARIIRMAVFGFEMSEDAGPDGALLPRARDRAVFPQNGLVVSSV DVQSVEPVD
MVP_shoulder |
![]() |
---|
PFAM accession number: | PF11978 |
---|---|
Interpro abstract (IPR021870): | The major vault protein is the major polypeptide component of a large cellular ribonuclear protein complex found in the cytoplasm of eukaryotic cells. Several roles for vaults have been proposed. Vault proteins have been associated with development of multi-drug resistance [ (PUBMED:23083532) ]. They have also being implicated in the regulation of several cellular processes including transport mechanisms, signal transmission and immune responses [ (PUBMED:18759128) ]. This domain is found in the Major Vault Protein and has been called the shoulder domain [ (PUBMED:19150846) ]. This family includes two bacterial proteins A6FXE2 and A1ZGE7 . This suggests that some bacteria may possess vault particles. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MVP_shoulder