The domain within your query sequence starts at position 524 and ends at position 580; the E-value for the MYT1 domain shown below is 2.7e-32.
YRPNVAPATPRANLAKELEKFSKVTFDYASFDAQVFGKRMLAPKIQTSETSPKAFQC
MYT1 |
---|
PFAM accession number: | PF08474 |
---|---|
Interpro abstract (IPR013681): | This domain is found in the myelin transcription factor 1 (MYT1) of chordates. MYT1 contains C2HC zinc finger domains ( IPR002515 ) and is expressed in developing neurons of the central nervous system [ (PUBMED:9373037) ] where it is involved in the selection of neuronal precursor cells [ (PUBMED:8980226) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MYT1