The domain within your query sequence starts at position 2 and ends at position 115; the E-value for the Mago_nashi domain shown below is 3.4e-59.

MFFLSLHTGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPD
RVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFS

Mago_nashi

Mago_nashi
PFAM accession number:PF02792
Interpro abstract (IPR004023):

This family was originally identified in Drosophila and called mago nashi, it is a strict maternal effect, grandchildless-like, gene [ (PUBMED:1765008) ]. The protein is an integral member of the exon junction complex (EJC). The EJC is a multiprotein complex that is deposited on spliced mRNAs after intron removal at a conserved position upstream of the exon-exon junction, and transported to the cytoplasm where it has been shown to influence translation, surveillance, and localization of the spliced mRNA. It consists of four core proteins (eIF4AIII, Barentsz [Btz], Mago, and Y14), mRNA, and ATP and is supposed to be a binding platform for more peripherally and transiently associated factors along mRNA travel. Mago and Y14 form a stable heterodimer that stabilizes the complex by inhibiting eIF4AIII's ATPase activity. Mago-Y14 heterodimer has been shown to interact with the cytoplasmic protein PYM, an EJC disassembly factor, and specifically binds to the karyopherin nuclear receptor importin 13 [ (PUBMED:18164611) (PUBMED:20818392) (PUBMED:20946982) (PUBMED:15734573) (PUBMED:12781131) (PUBMED:15145352) (PUBMED:18423193) (PUBMED:1765008) (PUBMED:10656761) (PUBMED:10662555) (PUBMED:11707413) (PUBMED:9272960) (PUBMED:12730685) (PUBMED:14968132) (PUBMED:15567724) (PUBMED:16380844) (PUBMED:17545126) ].

The human homologue has been shown to interact with an RNA binding protein, ribonucleoprotein rbm8 ( Q9Y5S9 ) [ (PUBMED:10662555) ]. An RNAi knockout of the Caenorhabditis elegans homologue causes masculinization of the germ line (Mog phenotype) hermaphrodites, suggesting it is involved in hermaphrodite germ-line sex determination [ (PUBMED:10656761) ] but the protein is also found in hermaphrodites and other organisms without a sexual differentiation.

GO process:RNA splicing (GO:0008380)
GO component:exon-exon junction complex (GO:0035145)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mago_nashi