SMART: Pfam domain MaoC_dehydrat

The domain within your query sequence starts at position 346 and ends at position 451; the E-value for the MaoC_dehydrat_N domain shown below is 1.4e-8.

YALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFAKALH
GEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKE

MaoC_dehydrat_N

PFAM accession number:	PF13452
Interpro abstract (IPR039569):	Hydratase 2 (2-enoyl-CoA hydratase 2, (R)-specific 2-enoyl-CoA hydratase) catalyzes reversibly the addition of water to the beta-carbon of trans-2-enoyl-CoA. In eukaryotes hydratase 2 is apart of multifunctional enzyme (peroxisomal multifunctional enzyme type 2) [ (PUBMED:15644212) ]. The overall structure of the two-domain subunit of eukaryotic 2-enoyl-CoA hydratase 2 resembles the homodimeric structures of prokaryotic (R)-specific 2-enoyl-CoA hydratase and beta-hydroxydecanoyl thiol ester dehydrase. Divergence in eukaryotes has led to two distinct domains [ (PUBMED:15051722) ], this one and the MaoC-like dehydratase domain ( IPR002539 ).

PFAM accession number:

PF13452

Interpro abstract (IPR039569):

Hydratase 2 (2-enoyl-CoA hydratase 2, (R)-specific 2-enoyl-CoA hydratase) catalyzes reversibly the addition of water to the beta-carbon of trans-2-enoyl-CoA. In eukaryotes hydratase 2 is apart of multifunctional enzyme (peroxisomal multifunctional enzyme type 2) [ (PUBMED:15644212) ]. The overall structure of the two-domain subunit of eukaryotic 2-enoyl-CoA hydratase 2 resembles the homodimeric structures of prokaryotic (R)-specific 2-enoyl-CoA hydratase and beta-hydroxydecanoyl thiol ester dehydrase. Divergence in eukaryotes has led to two distinct domains [ (PUBMED:15051722) ], this one and the MaoC-like dehydratase domain ( IPR002539 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MaoC_dehydrat_N