The domain within your query sequence starts at position 22 and ends at position 142; the E-value for the MaoC_dehydratas domain shown below is 2e-21.
QYVHTKVGDRAELSRAFTQQDVATFSELTGDANPLHLSEDFAKHSKFGKTIVHGVLINGL ISALLGTKMPGPGCVFLSQEIKFPAPLYVGEVVLASAEVKRLKQSVAVVAVSCCVIESKK T
MaoC_dehydratas |
![]() |
---|
PFAM accession number: | PF01575 |
---|---|
Interpro abstract (IPR002539): | The maoC gene is part of a operon with maoA which is involved in the synthesis of monoamine oxidase [ (PUBMED:1556068) ]. The MaoC protein shares similarity with a region found in a wide variety of enzymes, such as peroxisomal hydratase-dehydrogenase-epimerase and fatty acid synthase beta subunit. A deletion mutant of the C-terminal 271 amino acids in peroxisomal hydratase-dehydrogenase-epimerase ( Q02207 ), corresponding to the MaoC domain, abolished its 2-enoyl-CoA hydratase activity, suggesting that this region may be a hydratase enzyme [ (PUBMED:1551874) ]. Several bacterial proteins that are composed solely of this domain have (R)-specific enoyl-CoA hydratase activity [ (PUBMED:9457873) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MaoC_dehydratas