The domain within your query sequence starts at position 44 and ends at position 180; the E-value for the MatE domain shown below is 2.7e-29.
PAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQT YGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIP ALPAAFLYTLQVKYLLN
MatE |
---|
PFAM accession number: | PF01554 |
---|---|
Interpro abstract (IPR002528): | Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters. These proteins mediate resistance to a wide range of cationic dyes, fluroquinolones, aminoglycosides and other structurally diverse antibodies and drugs. MATE proteins are found in bacteria, archaea and eukaryotes. These proteins are predicted to have 12 alpha-helical transmembrane regions, some of the animal proteins may have an additional C-terminal helix [ (PUBMED:12603313) ]. |
GO process: | transmembrane transport (GO:0055085) |
GO component: | membrane (GO:0016020) |
GO function: | xenobiotic transmembrane transporter activity (GO:0042910), antiporter activity (GO:0015297) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MatE