The domain within your query sequence starts at position 51 and ends at position 132; the E-value for the MazG domain shown below is 7.2e-11.
HQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARC HVDLPQAVISKMDTNRQRYPVH
MazG |
 |
|---|
| PFAM accession number: | PF03819 |
|---|---|
| Interpro abstract (IPR004518): | This domain is found in a group of prokaryotic proteins which includes Escherichia coli MazG. The domain is about 100 amino acid residues in length and contains four conserved negatively charged residues that probably form an active site or metal binding site. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry MazG