The domain within your query sequence starts at position 424 and ends at position 708; the E-value for the Mcl1_mid domain shown below is 1.6e-103.
KPFQSSSTPLHLSHRFMVWNSVGIIRCYNDDQDSAIDVEFHDTSIHHATHLLNAFNYTMG TLSHEAILLACESADELASKLHCLHFSSWDSSKEWMVDMPQNEDIEAICLGLGWAAAATT ALLLRLFTIGGVQKEVFCLPGPVVSMAGHGEQLCIVYHRGTGFDGDQCLGVQLLELGRKK NQVLHGDPLPLTRKSYLTWLGFSAEGTPCYVDSEGCVRMLNRGLGNTWTPVCNIREHCKG KSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPY
Mcl1_mid |
---|
PFAM accession number: | PF12341 |
---|---|
Interpro abstract (IPR022100): | This entry represents the middle domain of minichromosome loss protein 1, which lies between a 7-bladed beta-propeller at the N terminus and a Homeobox (HMG) domain at the C terminus. The full length proteins with all three domains are referred to as DNA polymerase alpha accessory factor Mcl1, but the exact function of this domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mcl1_mid