The domain within your query sequence starts at position 17 and ends at position 749; the E-value for the Med15 domain shown below is 1.2e-276.

QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQA
SVSDPMNALQSLTGGPTPGAAGIGMPPRGPGQSLGGMGGLGAMGQPLPLSGQPPPGTSGM
APHGMAVVSTATPQTQLQLQQVALQQQQQQQQQQQFQQQQAALQQQQQQQQQQQQQQQFQ
AQQNAMQQQFQAVVQQQQLQQQQQQQHLIKLHHQSQQQQIQQQQLQRMAQLQLQQQQQQQ
QQQALQAQPPMQQPSMQQPQPPPSQALPQQLSQLHHPQHHQPPPQAQQSPIAQNQPPQIP
PQSQSQPLVSQAQALPGPMLYAAQQQLKFVRAPMVVQQPQVQPQVQQVQPQVQPQAAVQA
AQSAQMVAPGVQVSQSSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGSQPNSNVSSGPAP
SPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDK
LKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKL
KNDMAVPTPPPPPVLPTKQQDLCQPLLDAVLANIRSPVFNHSLYRTFVPAMMAIHGPPIV
SPVVCSRKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDL
PSVPPLELSVPADYPAQSPMWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNT
WAQSIHQACLSAA

Med15

• PFAM accession number: PF09606
• Interpro abstract (IPR019087):

  The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.

  The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11.

  The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation.

  • The head module contains: MED6, MED8, MED11, SRB4/MED17, SRB5/MED18, ROX3/MED19, SRB2/MED20 and SRB6/MED22.
  • The middle module contains: MED1, MED4, NUT1/MED5, MED7, CSE2/MED9, NUT2/MED10, SRB7/MED21 and SOH1/MED31. CSE2/MED9 interacts directly with MED4.
  • The tail module contains: MED2, PGD1/MED3, RGR1/MED14, GAL11/MED15 and SIN4/MED16.
  • The CDK8 module contains: MED12, MED13, CCNC and CDK8.

  Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP.

  The proteins in this entry represent subunit Med15 of the Mediator complex. They contain a single copy of the approximately 70 residue ARC105 domain. The ARC105 domain of the ARC-Mediator co-activator is a three-helix bundle with marked similarity to the KIX domain. The sterol regulatory element binding protein (SREBP) family of transcription activators use the ARC105 subunit to activate target genes in the regulation of cholesterol and fatty acid homeostasis. In addition, ARC105 is a critical transducer of gene activation signals that control early metazoan development [ (PUBMED:16799563) ].

• GO process: regulation of transcription by RNA polymerase II (GO:0006357)
• GO component: mediator complex (GO:0016592)
• GO function: transcription coregulator activity (GO:0003712)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med15