The domain within your query sequence starts at position 27 and ends at position 77; the E-value for the Med26 domain shown below is 5.1e-17.
LLRELKNMPITLHLLQSTRVGMSVNALRKQSSDEELIALAKSLIKSWKKLL
Med26 |
![]() |
---|
PFAM accession number: | PF08711 |
---|---|
Interpro abstract (IPR017923): | The TFIIS N-terminal domain is a compact four-helix bundle. The hydrophobic core residues of helices 2, 3, and 4 are well conserved among TFIIS domains, although helix 1 is less conserved [ (PUBMED:16648364) ]. Transcription factor IIS (TFIIS) is a transcription elongation factor that increases the overall transcription rate of RNA polymerase II by reactivating transcription elongation complexes that have arrested transcription. The three structural domains of TFIIS are conserved from yeast to human. The 80 or so N-terminal residues form a protein interaction domain containing a conserved motif, which has been called the LW motif because of the invariant leucine and tryptophan residues it contains. This N-terminal domain is not required for transcriptional activity, and while a similar sequence has been identified in other transcription factors, and proteins that are predominantly nuclear localized [ (PUBMED:10811649) (PUBMED:16648364) ], the domain is also found in proteins not directly involved in transcription. This domain is found in (amongst others):
|
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med26