The domain within your query sequence starts at position 177 and ends at position 405; the E-value for the Med26_M domain shown below is 3e-80.
ASPLPTNGISGSPESLPSPLDGSGHLGPDGSRLEPSDNEKHSTKIPVNAVRPRPSSPGLG KPPVPCLQTKAAQLQQLDRADESPGPPYPRGSSRCSFSPRNSRHEGSFSRHRSSYIPKGQ VSSPSPWPQPPDNTQVPSPLPLAQPPTPPVRRQELLPNAESPVHWPEQSEGHPRLTGPAC RAGFSPDSSKADSDATSSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKP
Med26_M |
---|
PFAM accession number: | PF15694 |
---|---|
Interpro abstract (IPR031417): | This entry represents the middle domain of subunit 26 of Mediator (Med26). Med19 and Med26 act synergistically to mediate the interaction between Mediator and REST, a Kruppel-type zinc finger transcription factor that binds to a 21-bp RE1 silencing element present in over 900 human genes [ (PUBMED:19049968) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Med26_M