The domain within your query sequence starts at position 1 and ends at position 280; the E-value for the Mei4 domain shown below is 2.5e-99.
MDDSGCVLSNEQRNEPAELSQHFVESTDPPLLPLPLEKRPRTTLENPLSSHMQFFQHLLE LKKWTESSSLKVYLTHFEKDSSTVSDSVSQLLDALITFYRNPKLPFSSFWTEAVGTLARL ASDFNLSNHIFKRCSKKLEEFEKTLLQAILENNSINRFQVQRYVSQSLVTLGSCSLLRKS IISLLLSEVNSFVDDLGAIDQDQGIYDVTRYENIFSLFWILEQVLQQAPQGDRTAHMDHS IPEMQTFLQKHDEVIFRLSDAFPLFAFYLWRLGVLLNSAE
Mei4 |
![]() |
---|
PFAM accession number: | PF13971 |
---|---|
Interpro abstract (IPR025888): | Meiosis-specific protein MEI4 is required for meiotic induction of recombination, viable spore production and chromosome synapsis. It is a component of the MER2-MEI4-REC114 complex which seems to be required for meiotic double-strand break (DSB) formation [ (PUBMED:16783010) (PUBMED:20551173) ]. In Schizosaccharomyces pombe it is known as Rec24 [ (PUBMED:16303567) (PUBMED:21429938) ]. |
GO process: | DNA recombination (GO:0006310), meiotic DNA double-strand break formation (GO:0042138) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mei4