The domain within your query sequence starts at position 104 and ends at position 310; the E-value for the Mei5 domain shown below is 4.8e-73.

PAAPQPRENPPSPHSNSSGKQPLSGTPKERLKKARSSSHSFCSVVKRMKVENDENNETLS
EPGESSKEENCSKAQESLKNKDSEPGEKSSEEKNTCESKSSDTGSSNALPKESENAIIRE
KLKQEKIRLIRQVEEKEDLLRRLKLVKMYRIKNDVTELENLIKKWRKCGQRLLCELQSIM
SEDEDEKLTLTELIDFYGIDDNLLHYN

Mei5

Mei5
PFAM accession number:PF10376
Interpro abstract (IPR018468):

This entry includes Mei5 from budding yeasts and SFR1 from animals and fission yeasts. Although the fission yeast Swi5-Sfr1 complex is critical for homologous recombination repair, the budding yeast counterpart Sae3-Mei5 complex is meiosis-specific, interacts with Dmc1, and promotes assembly of Dmc1 on meiotic chromosomes [ (PUBMED:21252223) ].

SFR is a component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination [ (PUBMED:21252223) ].

Mei5 is one of a pair of meiosis-specific proteins which facilitate the loading of Dmc1 on to Rad51 on DNA at double-strand breaks during recombination. Recombination is carried out by a large protein complex based around the two RecA homologues, Rad51 and Dmc1 [ (PUBMED:15620352) ]. This complex may play both a catalytic and a structural role in the interaction between homologous chromosomes during meiosis. Mei5 is seen to contain a coiled-coli region.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mei5