The domain within your query sequence starts at position 40 and ends at position 205; the E-value for the Mem_trans domain shown below is 3.3e-15.

LFPALLECFGIVLCGYIAGRANIITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWA
FLYSVLIGKASVFFIVCVLTLLVASPESRFSKAGLFPIFATQSNDFALGYPIVEALYQST
YPEYLQYIYLVAPISLMMLNPIGFIFCEIQKSKDTQNASQNKAKIV

Mem_trans

Mem_trans
PFAM accession number:PF03547
Interpro abstract (IPR004776):

This entry represents a mostly uncharacterised family of membrane transport proteins found in eukaryotes, bacteria and archaea. Most characterised members of this family are the PIN components of auxin efflux systems from plants. These carriers are saturable, auxin-specific, and localized to the basal ends of auxin transport-competent cells [ (PUBMED:16054428) (PUBMED:15564124) ]. Plants typically posses several of these proteins, each displaying a unique tissue-specific expression pattern. They are expressed in almost all plant tissues including vascular tissues and roots, and influence many processes including the establishment of embryonic polarity, plant growth, apical hook formation in seedlings and the photo- and gravitrophic responses. These plant proteins are typically 600-700 amino acyl residues long and exhibit 8-12 transmembrane segments.

GO process:transmembrane transport (GO:0055085)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mem_trans