The domain within your query sequence starts at position 1 and ends at position 135; the E-value for the Menin domain shown below is 1.6e-81.
VNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQLLWLLYDLG HLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYQDEHIYPYMYLAGYHCRN RNVREALQAWADTAT
Menin |
![]() |
---|
PFAM accession number: | PF05053 |
---|---|
Interpro abstract (IPR007747): | The tumour suppressor gene MEN1 is mutated in patients with a dominantly inherited tumour syndrome, multiple endocrine neoplasia type 1 (MEN1) [ (PUBMED:12145286) ]. The MEN1 gene encodes a protein known as Menin, which is located predominantly in the nucleus. Menin has been shown to interact with the mixed lineage leukemia (MLL) protein, a histone H3 lysine 4 methyltransferase, and plays a critical role in hematopoiesis and leukemogenesis [ (PUBMED:21740816) ]. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Menin