The domain within your query sequence starts at position 87 and ends at position 217; the E-value for the Metallophos domain shown below is 6.7e-9.
TRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGN HELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGS PWQPWFYGWGF
Metallophos |
---|
PFAM accession number: | PF00149 |
---|---|
Interpro abstract (IPR004843): | This domain is found in a diverse range of phosphoesterases [ (PUBMED:9685491) ], including bis(5'-nucleosyl)-tetraphosphatase (apaH), nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or archaeal/yeast Mre11. The most conserved regions in this domain centre around the metal chelating residues. |
GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Metallophos