The domain within your query sequence starts at position 420 and ends at position 482; the E-value for the Metallophos_C domain shown below is 4.5e-22.
GPVHIITGSAGCEELLTPFVRKPRPWSAVRVKEYGYTRMHILNGTHMHIQQVSDDQDGKI VDD
Metallophos_C |
---|
PFAM accession number: | PF14008 |
---|---|
Interpro abstract (IPR025733): | This domain is found at the C terminus of purple acid phosphatase proteins [ (PUBMED:12021284) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Metallophos_C