The domain within your query sequence starts at position 64 and ends at position 226; the E-value for the Methyltransf_3 domain shown below is 1.2e-16.
HILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAPACVLELGTYCGYSTLLIARALPPG SRLLTVERDSRTAAVAEKVIRLAGFDEQMVELIAGSSEEVIPRLRAQHQLNRADLVLLAH RPRYYLRDLQLLEAHALLPHGATVLADHVLFPGAPRFLQYTKS
Methyltransf_3 |
---|
PFAM accession number: | PF01596 |
---|---|
Interpro abstract (IPR002935): | Members of this family are O-methyltransferases, including catechol O-methyltransferase [ (PUBMED:16618795) ], caffeoyl-CoA O-methyltransferase [ (PUBMED:15734921) ] and norbelladine 4'-O-methyltransferase [ (PUBMED:25061748) ]. The family includes also bacterial O-methyltransferases that may be involved in antibiotic production [ (PUBMED:8936303) (PUBMED:31147608) ]. |
GO function: | O-methyltransferase activity (GO:0008171) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_3