The domain within your query sequence starts at position 8 and ends at position 78; the E-value for the Methyltransf_PK domain shown below is 1.8e-30.

DEKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALD
CGAGIGRITKR

Methyltransf_PK

Methyltransf_PK
PFAM accession number:PF05891
Interpro abstract (IPR008576):

All fungal and animal N-terminally methylated proteins contain a unique N-terminal motif, Met-(Ala/Pro/Ser)-Pro-Lys. Alpha-N-methyltransferase methylates the N terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. It catalyses mono-, di- or tri-methylation of the exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif [ (PUBMED:20481588) ].

GO process:N-terminal protein amino acid methylation (GO:0006480)
GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Methyltransf_PK