The domain within your query sequence starts at position 1 and ends at position 190; the E-value for the Mg_trans_NIPA domain shown below is 1.2e-47.
XFVGCGLAIVGTYLLVTFAPNSHEKMTGENIARHLVSWPFLLYMLVAIVLFCLLLYFYKE RNANSIVVILLLVALLGSMTVVTVKAVSGMLVLSIQGNLQLDYPIFYVMFVCMVATAIYQ ATFLSEASQIYDSSLIASVGYILSTTAAITAGAIFYLDFLGEEALHICMFALGCLIAFLG VFLITRNRKK
Mg_trans_NIPA |
![]() |
---|
PFAM accession number: | PF05653 |
---|---|
Interpro abstract (IPR008521): | NIPA (nonimprinted in Prader-Willi/Angelman syndrome) is a family of integral membrane proteins which function as magnesium transporters [ (PUBMED:17166836) (PUBMED:18667602) ]. This entry also includes a group of uncharacterised bacterial proteins, such as Cgl0250 (UniProt:P42459) from Corynebacterium glutamicum. |
GO process: | magnesium ion transport (GO:0015693) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | magnesium ion transmembrane transporter activity (GO:0015095) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mg_trans_NIPA