The domain within your query sequence starts at position 411 and ends at position 580; the E-value for the Milton domain shown below is 5e-72.
KQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDVSNVVLDNKTNSILLETEAA DLGNEDHNKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLRELAEKGEL HSGSLTPTESIMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGS
Milton |
![]() |
---|
PFAM accession number: | PF12448 |
---|---|
Interpro abstract (IPR022154): | This domain can be found at the C terminus of the eukaryotic trafficking kinesin-binding proteins, including TRAK1 and TRAK2. TRAK1 binds to both kinesin-1 and dynein/dynactin, is prominently localized in axons, and is needed for normal axon outgrowth, whereas TRAK2 predominantly interacts with dynein/dynactin, is more abundantly present in dendrites, and is required for dendritic development [ (PUBMED:23395375) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Milton