The domain within your query sequence starts at position 67 and ends at position 171; the E-value for the Mis14 domain shown below is 7e-27.
DVRELALRDAQWTFESAVQENVSFNGQAWEEAKEHGLMDSDIKVLEDEFDELIVDVATKR RQYPRRILESVIKTLKAQHASLKQYHPVVHPLDLKCDPDPGQQLS
Mis14 |
 |
|---|
| PFAM accession number: | PF08641 |
|---|---|
| Interpro abstract (IPR013950): | This entry includes Mis14 from S. pombe, Nsl1 from S. cerevisiae and Nsl1 homologues from animals. MIs14 is a component of the NMS (Ndc80-MIND-Spc7) super complex which has a role in kinetochore function during late meiotic prophase and throughout the mitotic cell cycle [ (PUBMED:15369671) ]. Nsl1 is an essential component of the kinetochore MIND complex, which is required for the spindle checkpoint and kinetochore integrity [ (PUBMED:14633972) ]. |
| GO process: | mitotic sister chromatid segregation (GO:0000070) |
| GO component: | kinetochore (GO:0000776) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mis14