The domain within your query sequence starts at position 247 and ends at position 359; the E-value for the MitMem_reg domain shown below is 7e-27.

DTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADN
TVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLV

MitMem_reg

MitMem_reg
PFAM accession number:PF13012
Interpro abstract (IPR024969):

This domain is found at the C terminus of many regulatory proteins, including the yeast proteasomal subunit Rpn11 and eukaryotic initiation factor 3 subunit F (eIF3f). The Rpn11 C-terminal domain is necessary for normal mitochondrial morphology and function and is thought to regulate the mitochondrial fission and tubulation processes [ (PUBMED:18172023) ]. The eIF3f C-terminal domain is critical for proper eIF3f activity in skeletal muscle through its interaction with mTOR (also known as FRAP, RAFT1 or RAPT) [ (PUBMED:19073596) (PUBMED:20126553) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry MitMem_reg