The domain within your query sequence starts at position 10 and ends at position 125; the E-value for the Mito_morph_reg domain shown below is 1.1e-60.

ATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTA
VLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAY

Mito_morph_reg

Mito_morph_reg
PFAM accession number:PF14972
Interpro abstract (IPR026120):

TMEM11 (also called PMI in Drosophila) regulates mitochondrial morphogenesis via a mechanism which is independent of mitofusins and dynamin-related protein 1 [ (PUBMED:21274005) ].

GO process:mitochondrion organization (GO:0007005)
GO component:integral component of mitochondrial inner membrane (GO:0031305)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mito_morph_reg