The domain within your query sequence starts at position 17 and ends at position 123; the E-value for the Mss4 domain shown below is 1.5e-40.
NRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPDLADGSNPDGDLLQEHWLVNDMFT FENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
Mss4 |
![]() |
---|
PFAM accession number: | PF04421 |
---|---|
Interpro abstract (IPR007515): | MSS4 (mammalian suppressor of Sec4) is an evolutionarily highly conserved protein, which is expressed in all mammalian tissues. Although it was first proposed to function as a guanine exchange factor (GEF) for Rab GTPases, it was soon described as a quite inefficient GEF and was thus suggested to function rather as a chaperone, protecting nucleotide free Rabs from degradation, than as a GEF [ (PUBMED:22495352) ]. The structure of MSS4 revealed a mostly beta fold stabilized by a Zn(2+) ion coordinated by cysteine residues from two CxxC motifs. The fold of the MSS4 domain consists of a central beta sheet (betaG-betaK) flanked by a beta hairpin (betaB-betaC) on one side and a small variable sheet on the other. A single Zn(2+) ion, coordinated by the thiol groups of cysteine residues from two CxxC motifs located in the betaB-betaC and betaI-betaJ loops, appears to play an important structural role by reinforcing the hydrophobic core formed by the betaB-betaC hairpin, the betaG-betaH loop, and the central beta sheet [ (PUBMED:7651540) (PUBMED:11258916) (PUBMED:16541104) ]. |
GO process: | small GTPase mediated signal transduction (GO:0007264) |
GO function: | guanyl-nucleotide exchange factor activity (GO:0005085) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mss4