The domain within your query sequence starts at position 485 and ends at position 535; the E-value for the Mtf2_C domain shown below is 5.8e-33.
ELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATA
Mtf2_C |
![]() |
---|
PFAM accession number: | PF14061 |
---|---|
Interpro abstract (IPR025894): | Mammalian Polycomb-like gene MTF2/PCL2 forms a complex with Polycomb repressive complex-2 (PRC2) and collaborates with PRC1 to achieve repression of Hox gene expression [ (PUBMED:21059868) ]. The human MTF2 gene is expressed in three splicing variants, each of them contains the short C-terminal domain defined here. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mtf2_C