The domain within your query sequence starts at position 139 and ends at position 226; the E-value for the Mtp domain shown below is 6.4e-17.
SFPYRDDIMSVNPTCLVLIILLFIGILLTLKGYLISCVWSCYRYINGRNSSDVLVYVTSN DTTVLLPPYDDATAVPSTAKEPPPPYVS
Mtp |
 |
|---|
| PFAM accession number: | PF03821 |
|---|---|
| Interpro abstract (IPR004687): | The lysosome associated protein transmembrane (LAPTM) family is comprised of three members: LAPTM5, LAPTM4a and LAPTM4b; they are lysosome-associated transmembrane proteins, found in mammals, insects and nematodes. |
| GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Mtp