The domain within your query sequence starts at position 1 and ends at position 130; the E-value for the Musclin domain shown below is 1.3e-68.
MLDWRLASTHFILAMIVMLWGSGKAFSVDLASQEFGTASLQSPPTAREEKSATELSAKLL RLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRI GRNRLSSSRG
Musclin |
---|
PFAM accession number: | PF11037 |
---|---|
Interpro abstract (IPR021088): | Osteocrin, also known as Musclin, is a muscle derived secretory peptide which induces insulin resistance in vitro. It encodes a 130 amino acid sequence including a N-terminal 30 amino acid signal sequence. Musclin expression level is tightly regulated by nutritional changes [ (PUBMED:18534131) (PUBMED:15044443) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Musclin