The domain within your query sequence starts at position 13 and ends at position 186; the E-value for the NAD_binding_10 domain shown below is 2.3e-11.

LVTGGCGFLGEHIVRMLLEREPRLRELRVFDLHLSSWLEELKAGPVQVTAIQGDVTQAHE
VAAAMSGSHVVIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTGTQYLVYTSSMEV
VGPNIKGHPFYRGNEDTPYEAVHSHPYPCSKALAEQLVLEANGRKAMLLGCTYW

NAD_binding_10

 NAD_binding_10
PFAM accession number:PF13460
Interpro abstract (IPR016040):

This entry represents NAD- and NADP-binding domains with a core Rossmann-type fold, which consists of 3-layers alpha/beta/alpha, where the six beta strands are parallel in the order 321456. Many different enzymes contain an NAD/NADP-binding domain, including:

  • C-terminal domain of alcohol dehydrogenases [ (PUBMED:15449945) ]
  • Tyrosine-dependent oxidoreductases (also known as short-chain dehydrogenases) [ (PUBMED:9174344) ]
  • N-terminal domain of glyceraldehyde-3-phosphate dehydrogenase [ (PUBMED:10448043) ]
  • NAD-binding domain of formate/glycerate dehydrogenases [ (PUBMED:8114093) ]
  • N-terminal domain of sirohaem synthase [ (PUBMED:14595395) ]
  • N-terminal domain of lactate dehydrogenase [ (PUBMED:11276087) ]
  • N-terminal domain of 6-phosphogluconate dehydrogenase (the beta-sheet is extended to 8 strands) [ (PUBMED:17222187) ]
  • C-terminal domain of amino acid dehydrogenases (an extra N-terminal helix displaces the C-terminal helix [ (PUBMED:8591026) ]
  • NAD-binding domain of certain potassium channels [ (PUBMED:11301020) ]
  • C-terminal domain of the transcriptional repressor Rex [ (PUBMED:15642260) ]
  • Ornithine cyclodeaminase [ (PUBMED:15518536) ]
  • CoA-binding N-terminal domain of the alpha chain of succinyl-CoA synthetase [ (PUBMED:9917402) ]

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_10