The domain within your query sequence starts at position 25 and ends at position 186; the E-value for the NAD_binding_4 domain shown below is 6.6e-11.
GCALNQKGARVILFDITQPAQNLPEGIKFVCGDIRCLADVETAFQDAEKVACVFHVASYG MSGREQLNKTQIEEVNVGGTENILRACLERGVPRLVYTSTFNVIFGGQVIRNGDESLPYL PLHLHPDHYSRTKSIAEKKVLEANGLAFKQGDGILRTCAIRP
NAD_binding_4 |
![]() |
---|
PFAM accession number: | PF07993 |
---|---|
Interpro abstract (IPR013120): | This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila. A sequence-related jojoba acyl CoA reductase is also included. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAD_binding_4