SMART: Pfam domain NAGLU

The domain within your query sequence starts at position 471 and ends at position 731; the E-value for the NAGLU_C domain shown below is 4.5e-85.

AWVSSFAIRRYGVSQPDAVAAWKLLLRSVYNCSGEACSGHNRSPLVKRPSLQMSTAVWYN
RSDVFEAWRLLLTAAPNLTTSPAFRYDLLDVTRQAVQELVSLCYEEARTAYLKQELDLLL
RAGGLLVYKLLPTLDELLASSSHFLLGTWLDQARKAAVSEAEAQFYEQNSRYQITLWGPE
GNILDYANKQLAGLVADYYQPRWCLFLGTLAHSLARGVPFQQHEFEKNVFPLEQAFVYNK
KRYPSQPRGDTVDLSKKIFLK

NAGLU_C

PFAM accession number:	PF12972
Interpro abstract (IPR024732):	Alpha-N-acetylglucosaminidase is a lysosomal enzyme required for the stepwise degradation of heparan sulphate [ (PUBMED:10588735) ]. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB, or Sanfilippo syndrome type B) characterised by neurological dysfunction but relatively mild somatic manifestations [ (PUBMED:12049639) ]. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold [ (PUBMED:18443291) ].

PFAM accession number:

PF12972

Interpro abstract (IPR024732):

Alpha-N-acetylglucosaminidase is a lysosomal enzyme required for the stepwise degradation of heparan sulphate [ (PUBMED:10588735) ]. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB, or Sanfilippo syndrome type B) characterised by neurological dysfunction but relatively mild somatic manifestations [ (PUBMED:12049639) ]. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold [ (PUBMED:18443291) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAGLU_C