The domain within your query sequence starts at position 28 and ends at position 114; the E-value for the NAGLU_N domain shown below is 4.8e-24.
KAVRELVVRLLGPGPAANFLVSVERALADESGLDTYSLSGGGGVPVLVRGSTGVAAAAGL HRYLRDFCGCQVAWSSAQLHLPWPLPA
NAGLU_N |
![]() |
---|
PFAM accession number: | PF12971 |
---|---|
Interpro abstract (IPR024240): | Alpha-N-acetylglucosaminidase, is a lysosomal enzyme required for the stepwise degradation of heparan sulphate [ (PUBMED:10588735) ]. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterised by neurological dysfunction but relatively mild somatic manifestations [ (PUBMED:12049639) ]. The structure shows that the enzyme is composed of three domains. This entry represents the N-terminal domain of Alpha-N-acetylglucosaminidase which has an alpha-beta fold [ (PUBMED:18443291) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NAGLU_N